Sentencedict.com
 Directly to word page Vague search(google)
Home > Most recently in a sentence

Most recently in a sentence

  up(0)  down(0)
Sentence count:75Posted:2018-09-08Updated:2020-07-24
Similar words: recentlydecentlyindecentlymost importantlyantecedentlyrecentinnocentlycomplacentlyMeaning: adv. more recently than any other time. 
Random good picture Not show
61. Most recently the doctrine has been applied in cases involving oil spills.
62. Most recently the Oxfordshire town was home to violinist Alfredo Campoli.
63. He most recently led Goldman's team of China bankers landing deals in oil ,(http://sentencedict.com/most recently.html) gas and power.
64. If you do not specify a sequence number, the system retrieves the most recently run command.
65. I believe he is best suited to giving directions on the spot in support of somebody else, " she said of her husband, a former civil rights activist and most recently Japan's deputy premier."
66. Most recently, Mitch Richmond helped produce the horror flick, Chain Letter.
67. Most recently she served as assistant director - general for communicable diseases.
68. And then of course, there's Barney, who most recently bit a reporter.
69. Originally from Merseyside, she was most recently living in Leeds, Northern Constabulary said today.
70. Our most recently deceased centenarian in Okinawa caught a cold and died in her sleep.
71. Hence ending inventory consists of the most recently acquired goods.
72. Most recently, microprocessors have become more powerful, thanks to a change in the design approach.
73. The region is seismically active and has been subject to destructive earthquakes in the past, most recently in 1963 when Skopje was heavily damaged by a major earthquake.
74. Returns the remote hostname and port number for the packet most recently received by this socket.
75. The genetic material in them is indeed a hotchpotch derived from avian, human and swine sources, but all eight segments come most recently from pigs.
More similar words: recentlydecentlyindecentlymost importantlyantecedentlyrecentinnocentlycomplacentlyrecurrentlymagnificentlycentrepiecenerve centrestridentlystringentlymostlyrecencygentlyfrom strength to strengthmomentlypotentlyfluentlyardentlyurgentlyabsentlysilentlyintentlypatentlydecentfrequentlyapparently
Total 75, 30 Per page  3/3  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words